PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr1g053715.1
Common NameMTR_1g053715
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family SBP
Protein Properties Length: 351aa    MW: 38267.6 Da    PI: 9.0277
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr1g053715.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP135.61.5e-4273150178
                      --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
              SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                      +CqvegC++dls ak y++rhkvC +hsk+p+v+vsgleqrfCqqCsrfh+l efD++krsCrrrLa+hnerrrk+q+
  Medtr1g053715.1  73 RCQVEGCKVDLSGAKAYYSRHKVCCMHSKSPSVVVSGLEQRFCQQCSRFHQLPEFDQGKRSCRRRLAGHNERRRKPQP 150
                      6**************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.7E-3467135IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.38571148IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.57E-4072153IPR004333Transcription factor, SBP-box
PfamPF031103.2E-3274147IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
MSSGFVPSPS SPPNSSTEFL DGLKFGQKIY FEDATSTVVV PASQTKPNAI GVGGSSSSSS  60
SSGMKRGNNH PPRCQVEGCK VDLSGAKAYY SRHKVCCMHS KSPSVVVSGL EQRFCQQCSR  120
FHQLPEFDQG KRSCRRRLAG HNERRRKPQP SSFLTSRSPK LSSPTFGNNG KGNNDFLMEC  180
ASYQKISMGN ALSTPRSAKP VPGNQATQFT WQNNSSTTSD FFLQGTNFHA PPTRHLPIMD  240
NYNEVTDSSC ALSLLSNQTW CSRNTTPPSV EMNNLLNFNG SLTTQSSQVV PDYQLQTNAS  300
SWFLKGVDSR NCLSPEAVPD LGLGQNSQAI HSDLHGELDV SQGKRHYWPL *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-3158147284squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013467649.10.0squamosa promoter-binding-like protein
TrEMBLA0A072VJ940.0A0A072VJ94_MEDTR; Squamosa promoter-binding-like protein
STRINGGLYMA19G32800.11e-125(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF42083359
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G57920.14e-55squamosa promoter binding protein-like 15
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]